Placeholder image of a protein
Icon representing a puzzle

2397: Electron Density Reconstruction 71

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two very short chains in this one.

Sequence
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,624
  2. Avatar for Go Science 2. Go Science 65 pts. 12,624
  3. Avatar for Contenders 3. Contenders 41 pts. 12,594
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 12,575
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 12,555
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 12,530
  7. Avatar for Australia 7. Australia 4 pts. 12,527
  8. Avatar for VeFold 8. VeFold 2 pts. 12,493
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 12,474
  10. Avatar for METU-BIN 10. METU-BIN 1 pt. 12,339
  1. Avatar for NPrincipi 21. NPrincipi Lv 1 15 pts. 12,528
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 14 pts. 12,527
  3. Avatar for guineapig 23. guineapig Lv 1 12 pts. 12,516
  4. Avatar for ecali 24. ecali Lv 1 11 pts. 12,514
  5. Avatar for pizpot 25. pizpot Lv 1 10 pts. 12,493
  6. Avatar for silent gene 26. silent gene Lv 1 8 pts. 12,486
  7. Avatar for equilibria 27. equilibria Lv 1 7 pts. 12,480
  8. Avatar for Larini 28. Larini Lv 1 7 pts. 12,478
  9. Avatar for akaaka 29. akaaka Lv 1 6 pts. 12,476
  10. Avatar for Joanna_H 30. Joanna_H Lv 1 5 pts. 12,474

Comments