Placeholder image of a protein
Icon representing a puzzle

2399: Revisiting Puzzle 135: E. coli

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,101
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,962
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,817
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 8,697
  1. Avatar for gmn 11. gmn Lv 1 52 pts. 9,619
  2. Avatar for fpc 12. fpc Lv 1 48 pts. 9,616
  3. Avatar for BackBuffer 13. BackBuffer Lv 1 45 pts. 9,606
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 42 pts. 9,605
  5. Avatar for pizpot 15. pizpot Lv 1 39 pts. 9,602
  6. Avatar for akaaka 16. akaaka Lv 1 36 pts. 9,596
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 33 pts. 9,586
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 31 pts. 9,581
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 28 pts. 9,566
  10. Avatar for phi16 20. phi16 Lv 1 26 pts. 9,555

Comments