Placeholder image of a protein
Icon representing a puzzle

2399: Revisiting Puzzle 135: E. coli

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,903
  2. Avatar for Go Science 2. Go Science 68 pts. 9,785
  3. Avatar for Contenders 3. Contenders 44 pts. 9,662
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 9,616
  5. Avatar for VeFold 5. VeFold 16 pts. 9,602
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,586
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,523
  8. Avatar for Australia 8. Australia 3 pts. 9,516
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,478
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,443

  1. Avatar for gmn 11. gmn Lv 1 52 pts. 9,619
  2. Avatar for fpc 12. fpc Lv 1 48 pts. 9,616
  3. Avatar for BackBuffer 13. BackBuffer Lv 1 45 pts. 9,606
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 42 pts. 9,605
  5. Avatar for pizpot 15. pizpot Lv 1 39 pts. 9,602
  6. Avatar for akaaka 16. akaaka Lv 1 36 pts. 9,596
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 33 pts. 9,586
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 31 pts. 9,581
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 28 pts. 9,566
  10. Avatar for phi16 20. phi16 Lv 1 26 pts. 9,555

Comments