Placeholder image of a protein
Icon representing a puzzle

2399: Revisiting Puzzle 135: E. coli

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,903
  2. Avatar for Go Science 2. Go Science 68 pts. 9,785
  3. Avatar for Contenders 3. Contenders 44 pts. 9,662
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 9,616
  5. Avatar for VeFold 5. VeFold 16 pts. 9,602
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,586
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,523
  8. Avatar for Australia 8. Australia 3 pts. 9,516
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,478
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,443
  1. Avatar for Oransche 51. Oransche Lv 1 1 pt. 8,871
  2. Avatar for p127 52. p127 Lv 1 1 pt. 8,846
  3. Avatar for alyssa_d_V2.0 53. alyssa_d_V2.0 Lv 1 1 pt. 8,817
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 8,786
  5. Avatar for Kevonni 55. Kevonni Lv 1 1 pt. 8,782
  6. Avatar for Helisaf 56. Helisaf Lv 1 1 pt. 8,773
  7. Avatar for e235439 57. e235439 Lv 1 1 pt. 8,697
  8. Avatar for abiogenesis 58. abiogenesis Lv 1 1 pt. 8,647
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 8,549
  10. Avatar for Wildcard 34 60. Wildcard 34 Lv 1 1 pt. 8,457

Comments