Placeholder image of a protein
Icon representing a puzzle

2399: Revisiting Puzzle 135: E. coli

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,903
  2. Avatar for Go Science 2. Go Science 68 pts. 9,785
  3. Avatar for Contenders 3. Contenders 44 pts. 9,662
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 9,616
  5. Avatar for VeFold 5. VeFold 16 pts. 9,602
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,586
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,523
  8. Avatar for Australia 8. Australia 3 pts. 9,516
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,478
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,443
  1. Avatar for MicElephant 21. MicElephant Lv 1 24 pts. 9,545
  2. Avatar for Simek 22. Simek Lv 1 22 pts. 9,523
  3. Avatar for AlkiP0Ps 23. AlkiP0Ps Lv 1 21 pts. 9,516
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 19 pts. 9,478
  5. Avatar for Joanna_H 25. Joanna_H Lv 1 17 pts. 9,443
  6. Avatar for heather-1 26. heather-1 Lv 1 16 pts. 9,443
  7. Avatar for alcor29 27. alcor29 Lv 1 15 pts. 9,429
  8. Avatar for Vinara 28. Vinara Lv 1 13 pts. 9,369
  9. Avatar for Tian00 29. Tian00 Lv 1 12 pts. 9,361
  10. Avatar for georg137 30. georg137 Lv 1 11 pts. 9,357

Comments