Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 28,003
  2. Avatar for Go Science 2. Go Science 63 pts. 27,992
  3. Avatar for Contenders 3. Contenders 37 pts. 27,966
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 27,962
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 27,906
  6. Avatar for Australia 6. Australia 5 pts. 27,895
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 27,847
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 27,756
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 27,652
  10. Avatar for VeFold 10. VeFold 1 pt. 27,592
  1. Avatar for grogar7 11. grogar7 Lv 1 44 pts. 27,942
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 40 pts. 27,940
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 37 pts. 27,932
  4. Avatar for drjr 14. drjr Lv 1 33 pts. 27,910
  5. Avatar for blazegeek 15. blazegeek Lv 1 30 pts. 27,908
  6. Avatar for fpc 16. fpc Lv 1 27 pts. 27,906
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 25 pts. 27,895
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 22 pts. 27,889
  9. Avatar for georg137 19. georg137 Lv 1 20 pts. 27,858
  10. Avatar for ichwilldiesennamen 20. ichwilldiesennamen Lv 1 18 pts. 27,854

Comments