Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 28,003
  2. Avatar for Go Science 2. Go Science 63 pts. 27,992
  3. Avatar for Contenders 3. Contenders 37 pts. 27,966
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 27,962
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 27,906
  6. Avatar for Australia 6. Australia 5 pts. 27,895
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 27,847
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 27,756
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 27,652
  10. Avatar for VeFold 10. VeFold 1 pt. 27,592
  1. Avatar for carsonfb 31. carsonfb Lv 1 5 pts. 27,722
  2. Avatar for roarshock 32. roarshock Lv 1 4 pts. 27,679
  3. Avatar for manu8170 33. manu8170 Lv 1 4 pts. 27,673
  4. Avatar for maithra 34. maithra Lv 1 3 pts. 27,659
  5. Avatar for ShadowTactics 35. ShadowTactics Lv 1 3 pts. 27,652
  6. Avatar for Larini 36. Larini Lv 1 3 pts. 27,600
  7. Avatar for Tian00 37. Tian00 Lv 1 2 pts. 27,592
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 2 pts. 27,584
  9. Avatar for Hexafluorouranate 39. Hexafluorouranate Lv 1 2 pts. 27,574
  10. Avatar for ProfVince 40. ProfVince Lv 1 2 pts. 27,525

Comments