Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 28,003
  2. Avatar for Go Science 2. Go Science 63 pts. 27,992
  3. Avatar for Contenders 3. Contenders 37 pts. 27,966
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 27,962
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 27,906
  6. Avatar for Australia 6. Australia 5 pts. 27,895
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 27,847
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 27,756
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 27,652
  10. Avatar for VeFold 10. VeFold 1 pt. 27,592
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 16 pts. 27,847
  2. Avatar for akaaka 22. akaaka Lv 1 15 pts. 27,831
  3. Avatar for phi16 23. phi16 Lv 1 13 pts. 27,822
  4. Avatar for silent gene 24. silent gene Lv 1 12 pts. 27,818
  5. Avatar for guineapig 25. guineapig Lv 1 10 pts. 27,811
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 9 pts. 27,786
  7. Avatar for jausmh 27. jausmh Lv 1 8 pts. 27,785
  8. Avatar for Steven Pletsch 28. Steven Pletsch Lv 1 7 pts. 27,776
  9. Avatar for Joanna_H 29. Joanna_H Lv 1 6 pts. 27,756
  10. Avatar for alcor29 30. alcor29 Lv 1 6 pts. 27,728

Comments