Placeholder image of a protein
Icon representing a puzzle

2412: Electron Density Reconstruction 76

Closed since about 2 years ago

Novice Prediction Electron Density Kinect

Summary


Created
January 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
SMYQLWKMILQETGKNAVPSYGLYGCNCGVGSRGKPKDATDRCCFVHKCCYKKLTDCSPKTDSYSYSWKDKTIVCGDNNPCLQEMCECDKAVAICLRENLDTYNKNYKIYPKPLCKKADAC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,390
  2. Avatar for Go Science 2. Go Science 56 pts. 21,372
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 29 pts. 21,345
  4. Avatar for Contenders 4. Contenders 14 pts. 21,321
  5. Avatar for Australia 5. Australia 6 pts. 21,309
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 21,247
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 21,155
  8. Avatar for VeFold 8. VeFold 1 pt. 20,856
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 20,723
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 20,513

  1. Avatar for guineapig 11. guineapig Lv 1 42 pts. 21,293
  2. Avatar for blazegeek 12. blazegeek Lv 1 38 pts. 21,280
  3. Avatar for BackBuffer 13. BackBuffer Lv 1 35 pts. 21,271
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 31 pts. 21,266
  5. Avatar for Steven Pletsch 15. Steven Pletsch Lv 1 28 pts. 21,261
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 26 pts. 21,260
  7. Avatar for jausmh 17. jausmh Lv 1 23 pts. 21,241
  8. Avatar for fpc 18. fpc Lv 1 21 pts. 21,231
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 19 pts. 21,230
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 17 pts. 21,226

Comments