Placeholder image of a protein
Icon representing a puzzle

2412: Electron Density Reconstruction 76

Closed since about 2 years ago

Novice Prediction Electron Density Kinect

Summary


Created
January 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
SMYQLWKMILQETGKNAVPSYGLYGCNCGVGSRGKPKDATDRCCFVHKCCYKKLTDCSPKTDSYSYSWKDKTIVCGDNNPCLQEMCECDKAVAICLRENLDTYNKNYKIYPKPLCKKADAC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,390
  2. Avatar for Go Science 2. Go Science 56 pts. 21,372
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 29 pts. 21,345
  4. Avatar for Contenders 4. Contenders 14 pts. 21,321
  5. Avatar for Australia 5. Australia 6 pts. 21,309
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 21,247
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 21,155
  8. Avatar for VeFold 8. VeFold 1 pt. 20,856
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 20,723
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 20,513

  1. Avatar for hansvandenhof 21. hansvandenhof Lv 1 15 pts. 21,221
  2. Avatar for alcor29 22. alcor29 Lv 1 13 pts. 21,217
  3. Avatar for MicElephant 23. MicElephant Lv 1 12 pts. 21,208
  4. Avatar for georg137 24. georg137 Lv 1 10 pts. 21,166
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 9 pts. 21,155
  6. Avatar for silent gene 26. silent gene Lv 1 8 pts. 21,148
  7. Avatar for phi16 27. phi16 Lv 1 7 pts. 21,080
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 6 pts. 20,999
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 5 pts. 20,991
  10. Avatar for roarshock 30. roarshock Lv 1 5 pts. 20,884

Comments