Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 10,705
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,609
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 10,006
  4. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,873

  1. Avatar for grogar7 11. grogar7 Lv 1 51 pts. 11,739
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 48 pts. 11,719
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 44 pts. 11,707
  4. Avatar for guineapig 14. guineapig Lv 1 41 pts. 11,687
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 38 pts. 11,668
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 35 pts. 11,664
  7. Avatar for Steven Pletsch 17. Steven Pletsch Lv 1 33 pts. 11,650
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 30 pts. 11,628
  9. Avatar for g_b 19. g_b Lv 1 28 pts. 11,612
  10. Avatar for Serca 20. Serca Lv 1 26 pts. 11,608

Comments