Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 10,705
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,609
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 10,006
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,897
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,873
  1. Avatar for Antibrad 31. Antibrad Lv 1 10 pts. 11,252
  2. Avatar for manu8170 32. manu8170 Lv 1 9 pts. 11,176
  3. Avatar for alcor29 33. alcor29 Lv 1 8 pts. 11,167
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 7 pts. 11,053
  5. Avatar for maithra 35. maithra Lv 1 6 pts. 11,047
  6. Avatar for roarshock 36. roarshock Lv 1 6 pts. 11,033
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 5 pts. 11,025
  8. Avatar for Larini 38. Larini Lv 1 5 pts. 10,920
  9. Avatar for jamiexq 39. jamiexq Lv 1 4 pts. 10,908
  10. Avatar for Vinara 40. Vinara Lv 1 4 pts. 10,894

Comments