Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 10,705
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,609
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 10,006
  4. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,873

  1. Avatar for AlphaFold2 51. AlphaFold2 Lv 1 1 pt. 10,609
  2. Avatar for Trajan464 52. Trajan464 Lv 1 1 pt. 10,606
  3. Avatar for apetrides 53. apetrides Lv 1 1 pt. 10,603
  4. Avatar for haleyg 54. haleyg Lv 1 1 pt. 10,596
  5. Avatar for pfirth 55. pfirth Lv 1 1 pt. 10,574
  6. Avatar for zbp 56. zbp Lv 1 1 pt. 10,518
  7. Avatar for DScott 57. DScott Lv 1 1 pt. 10,480
  8. Avatar for Arne Heessels 58. Arne Heessels Lv 1 1 pt. 10,465
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 10,462
  10. Avatar for koolcoder101 60. koolcoder101 Lv 1 1 pt. 10,447

Comments