Icon representing a puzzle

2417: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 10,705
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 10,609
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 10,006
  4. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,873

  1. Avatar for Sammy3c2b1a0 71. Sammy3c2b1a0 Lv 1 1 pt. 9,873
  2. Avatar for laughingllama 72. laughingllama Lv 1 1 pt. 9,853
  3. Avatar for furi0us 73. furi0us Lv 1 1 pt. 9,679
  4. Avatar for Plyn 74. Plyn Lv 1 1 pt. 9,663
  5. Avatar for aarushi1357 75. aarushi1357 Lv 1 1 pt. 9,627
  6. Avatar for Little B 77. Little B Lv 1 1 pt. 8,668
  7. Avatar for arcelia_bc 78. arcelia_bc Lv 1 1 pt. 8,654
  8. Avatar for spvincent 79. spvincent Lv 1 1 pt. 8,561
  9. Avatar for dymineoum 80. dymineoum Lv 1 1 pt. 8,561

Comments