Icon representing a puzzle

2420: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,190
  2. Avatar for Go Science 2. Go Science 71 pts. 12,174
  3. Avatar for Contenders 3. Contenders 49 pts. 12,013
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,916
  5. Avatar for Australia 5. Australia 22 pts. 11,894
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,779
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 11,733
  8. Avatar for VeFold 8. VeFold 5 pts. 11,695
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 3 pts. 11,658
  10. Avatar for Beta Folders 10. Beta Folders 2 pts. 11,497
  1. Avatar for mickloven 71. mickloven Lv 1 1 pt. 10,671
  2. Avatar for karolineroettger 72. karolineroettger Lv 1 1 pt. 10,651
  3. Avatar for crahman03 73. crahman03 Lv 1 1 pt. 10,648
  4. Avatar for AM0003 74. AM0003 Lv 1 1 pt. 10,620
  5. Avatar for GoonKing223 75. GoonKing223 Lv 1 1 pt. 10,592
  6. Avatar for mao5455 76. mao5455 Lv 1 1 pt. 10,554
  7. Avatar for JimmyKlein 77. JimmyKlein Lv 1 1 pt. 10,552
  8. Avatar for illex 78. illex Lv 1 1 pt. 10,542
  9. Avatar for Willimax 79. Willimax Lv 1 1 pt. 10,511
  10. Avatar for PerryL 80. PerryL Lv 1 1 pt. 10,507

Comments