Icon representing a puzzle

2420: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,190
  2. Avatar for Go Science 2. Go Science 71 pts. 12,174
  3. Avatar for Contenders 3. Contenders 49 pts. 12,013
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,916
  5. Avatar for Australia 5. Australia 22 pts. 11,894
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,779
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 11,733
  8. Avatar for VeFold 8. VeFold 5 pts. 11,695
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 3 pts. 11,658
  10. Avatar for Beta Folders 10. Beta Folders 2 pts. 11,497
  1. Avatar for jay0621 81. jay0621 Lv 1 1 pt. 10,498
  2. Avatar for Swapper242 82. Swapper242 Lv 1 1 pt. 10,492
  3. Avatar for furi0us 83. furi0us Lv 1 1 pt. 10,479
  4. Avatar for cdg5428 84. cdg5428 Lv 1 1 pt. 10,470
  5. Avatar for Norreland 85. Norreland Lv 1 1 pt. 10,463
  6. Avatar for jferry21 86. jferry21 Lv 1 1 pt. 10,389
  7. Avatar for JohnP0926 87. JohnP0926 Lv 1 1 pt. 10,134
  8. Avatar for beta_helix 88. beta_helix Lv 1 1 pt. 10,089
  9. Avatar for GHD 89. GHD Lv 1 1 pt. 9,927
  10. Avatar for 0mkar 90. 0mkar Lv 1 1 pt. 9,826

Comments