Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 2 pts. 9,490
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,110
  3. Avatar for OmHS 13. OmHS 1 pt. 8,869
  4. Avatar for Penn State Biomolecular Engineers 14. Penn State Biomolecular Engineers 1 pt. 6,653
  5. Avatar for BIOB101 - Discover Biology 15. BIOB101 - Discover Biology 1 pt. 6,523
  6. Avatar for That's a Wrap! 16. That's a Wrap! 1 pt. 6,308
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 0
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 0
  1. Avatar for georg137 21. georg137 Lv 1 25 pts. 17,547
  2. Avatar for guineapig 22. guineapig Lv 1 23 pts. 17,542
  3. Avatar for pfirth 23. pfirth Lv 1 21 pts. 17,537
  4. Avatar for hansvandenhof 24. hansvandenhof Lv 1 19 pts. 17,527
  5. Avatar for ComputerMage 25. ComputerMage Lv 1 18 pts. 17,515
  6. Avatar for dcrwheeler 26. dcrwheeler Lv 1 16 pts. 17,436
  7. Avatar for spvincent 27. spvincent Lv 1 15 pts. 17,354
  8. Avatar for Dr.Sillem 28. Dr.Sillem Lv 1 14 pts. 17,340
  9. Avatar for akaaka 29. akaaka Lv 1 12 pts. 17,282
  10. Avatar for jausmh 30. jausmh Lv 1 11 pts. 17,113

Comments