Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 18,730
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 74 pts. 18,572
  3. Avatar for Go Science 3. Go Science 54 pts. 18,473
  4. Avatar for Australia 4. Australia 38 pts. 18,336
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 27 pts. 18,130
  6. Avatar for Contenders 6. Contenders 18 pts. 18,122
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 17,931
  8. Avatar for BOINC@Poland 8. BOINC@Poland 8 pts. 17,739
  9. Avatar for Russian team 9. Russian team 5 pts. 17,515
  10. Avatar for VeFold 10. VeFold 3 pts. 17,340
  1. Avatar for georg137 21. georg137 Lv 1 25 pts. 17,547
  2. Avatar for guineapig 22. guineapig Lv 1 23 pts. 17,542
  3. Avatar for pfirth 23. pfirth Lv 1 21 pts. 17,537
  4. Avatar for hansvandenhof 24. hansvandenhof Lv 1 19 pts. 17,527
  5. Avatar for ComputerMage 25. ComputerMage Lv 1 18 pts. 17,515
  6. Avatar for dcrwheeler 26. dcrwheeler Lv 1 16 pts. 17,436
  7. Avatar for spvincent 27. spvincent Lv 1 15 pts. 17,354
  8. Avatar for Dr.Sillem 28. Dr.Sillem Lv 1 14 pts. 17,340
  9. Avatar for akaaka 29. akaaka Lv 1 12 pts. 17,282
  10. Avatar for jausmh 30. jausmh Lv 1 11 pts. 17,113

Comments