Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 21,148
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 12,466

  1. Avatar for RichGuilmain 51. RichGuilmain Lv 1 1 pt. 20,841
  2. Avatar for Arne Heessels 52. Arne Heessels Lv 1 1 pt. 20,840
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 20,783
  4. Avatar for dymineoum 54. dymineoum Lv 1 1 pt. 20,688
  5. Avatar for phi16 55. phi16 Lv 1 1 pt. 20,670
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 20,665
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 20,641
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 20,576
  9. Avatar for morganlovesscience 59. morganlovesscience Lv 1 1 pt. 20,535
  10. Avatar for furi0us 60. furi0us Lv 1 1 pt. 20,345

Comments