Placeholder image of a protein
Icon representing a puzzle

2427:Electron Density Reconstruction 81

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 28, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GSHMSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDSNQSVETIEVEIILPR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 22,197
  2. Avatar for Go Science 2. Go Science 63 pts. 22,187
  3. Avatar for Contenders 3. Contenders 37 pts. 22,133
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 22,131
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 22,058
  6. Avatar for Australia 6. Australia 5 pts. 22,045
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 22,045
  8. Avatar for Kotocycle 8. Kotocycle 1 pt. 22,004
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 21,579
  10. Avatar for VeFold 10. VeFold 1 pt. 21,343

  1. Avatar for RichGuilmain 51. RichGuilmain Lv 1 1 pt. 20,841
  2. Avatar for Arne Heessels 52. Arne Heessels Lv 1 1 pt. 20,840
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 20,783
  4. Avatar for dymineoum 54. dymineoum Lv 1 1 pt. 20,688
  5. Avatar for phi16 55. phi16 Lv 1 1 pt. 20,670
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 20,665
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 20,641
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 20,576
  9. Avatar for morganlovesscience 59. morganlovesscience Lv 1 1 pt. 20,535
  10. Avatar for furi0us 60. furi0us Lv 1 1 pt. 20,345

Comments