Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,332
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 9,234
  3. Avatar for OmHS 13. OmHS 1 pt. 8,976
  4. Avatar for BIOTF345 14. BIOTF345 1 pt. 8,858
  5. Avatar for Window Group 15. Window Group 1 pt. 8,361

  1. Avatar for dymineoum 51. dymineoum Lv 1 1 pt. 9,247
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 9,244
  3. Avatar for Antibrad 53. Antibrad Lv 1 1 pt. 9,234
  4. Avatar for Merf 54. Merf Lv 1 1 pt. 9,231
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 9,201
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 9,196
  7. Avatar for haleyg 57. haleyg Lv 1 1 pt. 9,189
  8. Avatar for Madis731 58. Madis731 Lv 1 1 pt. 9,181
  9. Avatar for vinsi 59. vinsi Lv 1 1 pt. 9,147
  10. Avatar for ivalnic 60. ivalnic Lv 1 1 pt. 9,118

Comments