Icon representing a puzzle

2423: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 9,332
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 9,234
  3. Avatar for OmHS 13. OmHS 1 pt. 8,976
  4. Avatar for BIOTF345 14. BIOTF345 1 pt. 8,858
  5. Avatar for Window Group 15. Window Group 1 pt. 8,361
  1. Avatar for Rilyhigg1 61. Rilyhigg1 Lv 1 1 pt. 9,089
  2. Avatar for HydrophillicHuman 62. HydrophillicHuman Lv 1 1 pt. 9,082
  3. Avatar for divider 63. divider Lv 1 1 pt. 9,017
  4. Avatar for U202342272 64. U202342272 Lv 1 1 pt. 9,015
  5. Avatar for U202342275 65. U202342275 Lv 1 1 pt. 9,009
  6. Avatar for futsall 66. futsall Lv 1 1 pt. 9,003
  7. Avatar for U202342273 67. U202342273 Lv 1 1 pt. 8,997
  8. Avatar for yvannam 68. yvannam Lv 1 1 pt. 8,983
  9. Avatar for Kyle123 69. Kyle123 Lv 1 1 pt. 8,976
  10. Avatar for Kineticcat_ 70. Kineticcat_ Lv 1 1 pt. 8,944

Comments