Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,810
  2. Avatar for That's a Wrap! 12. That's a Wrap! 1 pt. 10,655
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 9,601

  1. Avatar for rridk 81. rridk Lv 1 1 pt. 9,087
  2. Avatar for apwall21 82. apwall21 Lv 1 1 pt. 8,812
  3. Avatar for Richard00 83. Richard00 Lv 1 1 pt. 8,700
  4. Avatar for pikayandyou 84. pikayandyou Lv 1 1 pt. 8,656
  5. Avatar for spvincent 85. spvincent Lv 1 1 pt. 8,656
  6. Avatar for Astr0man98 86. Astr0man98 Lv 1 1 pt. 8,656
  7. Avatar for clairekingsbury 87. clairekingsbury Lv 1 1 pt. 8,656
  8. Avatar for RebeccaWebb 88. RebeccaWebb Lv 1 1 pt. 8,656

Comments