Icon representing a puzzle

2426: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,303
  2. Avatar for Go Science 2. Go Science 65 pts. 12,163
  3. Avatar for Contenders 3. Contenders 41 pts. 11,955
  4. Avatar for Australia 4. Australia 24 pts. 11,940
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 11,915
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 11,908
  7. Avatar for VeFold 7. VeFold 4 pts. 11,835
  8. Avatar for Kotocycle 8. Kotocycle 2 pts. 11,828
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 11,774
  10. Avatar for Russian team 10. Russian team 1 pt. 11,092
  1. Avatar for rridk 81. rridk Lv 1 1 pt. 9,087
  2. Avatar for apwall21 82. apwall21 Lv 1 1 pt. 8,812
  3. Avatar for Richard00 83. Richard00 Lv 1 1 pt. 8,700
  4. Avatar for pikayandyou 84. pikayandyou Lv 1 1 pt. 8,656
  5. Avatar for spvincent 85. spvincent Lv 1 1 pt. 8,656
  6. Avatar for RebeccaWebb 86. RebeccaWebb Lv 1 1 pt. 8,656
  7. Avatar for Astr0man98 87. Astr0man98 Lv 1 1 pt. 8,656
  8. Avatar for clairekingsbury 88. clairekingsbury Lv 1 1 pt. 8,656

Comments