Icon representing a puzzle

2429: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,661
  2. Avatar for Contenders 2. Contenders 71 pts. 11,449
  3. Avatar for Go Science 3. Go Science 49 pts. 11,442
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,413
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 11,361
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 11,300
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,297
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 11,167
  9. Avatar for Australia 9. Australia 3 pts. 11,097
  10. Avatar for VeFold 10. VeFold 2 pts. 11,079
  1. Avatar for fpc 11. fpc Lv 1 49 pts. 11,361
  2. Avatar for MicElephant 12. MicElephant Lv 1 46 pts. 11,348
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 42 pts. 11,346
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 39 pts. 11,339
  5. Avatar for Galaxie 15. Galaxie Lv 1 36 pts. 11,338
  6. Avatar for BackBuffer 16. BackBuffer Lv 1 33 pts. 11,326
  7. Avatar for georg137 17. georg137 Lv 1 31 pts. 11,306
  8. Avatar for blazegeek 18. blazegeek Lv 1 28 pts. 11,303
  9. Avatar for Joanna_H 19. Joanna_H Lv 1 26 pts. 11,300
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 24 pts. 11,297

Comments