Icon representing a puzzle

2429: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,661
  2. Avatar for Contenders 2. Contenders 71 pts. 11,449
  3. Avatar for Go Science 3. Go Science 49 pts. 11,442
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,413
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 11,361
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 11,300
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,297
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 11,167
  9. Avatar for Australia 9. Australia 3 pts. 11,097
  10. Avatar for VeFold 10. VeFold 2 pts. 11,079
  1. Avatar for silent gene 31. silent gene Lv 1 8 pts. 11,180
  2. Avatar for maithra 32. maithra Lv 1 7 pts. 11,171
  3. Avatar for Aubade01 33. Aubade01 Lv 1 7 pts. 11,171
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 6 pts. 11,167
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 5 pts. 11,123
  6. Avatar for AlkiP0Ps 36. AlkiP0Ps Lv 1 5 pts. 11,097
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 4 pts. 11,093
  8. Avatar for Hillbillie 38. Hillbillie Lv 1 4 pts. 11,079
  9. Avatar for Larini 39. Larini Lv 1 3 pts. 11,055
  10. Avatar for heather-1 40. heather-1 Lv 1 3 pts. 11,009

Comments