Icon representing a puzzle

2429: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,661
  2. Avatar for Contenders 2. Contenders 71 pts. 11,449
  3. Avatar for Go Science 3. Go Science 49 pts. 11,442
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,413
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 11,361
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 11,300
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,297
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 11,167
  9. Avatar for Australia 9. Australia 3 pts. 11,097
  10. Avatar for VeFold 10. VeFold 2 pts. 11,079
  1. Avatar for kitsoune 41. kitsoune Lv 1 3 pts. 11,004
  2. Avatar for VU21BTEN0100031 42. VU21BTEN0100031 Lv 1 2 pts. 10,995
  3. Avatar for Dr.Sillem 43. Dr.Sillem Lv 1 2 pts. 10,989
  4. Avatar for Idiotboy 44. Idiotboy Lv 1 2 pts. 10,988
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 10,975
  6. Avatar for ivalnic 46. ivalnic Lv 1 2 pts. 10,918
  7. Avatar for zbp 47. zbp Lv 1 1 pt. 10,894
  8. Avatar for pfirth 48. pfirth Lv 1 1 pt. 10,891
  9. Avatar for VU21BTEN0100033 49. VU21BTEN0100033 Lv 1 1 pt. 10,868
  10. Avatar for Alistair69 50. Alistair69 Lv 1 1 pt. 10,845

Comments