Icon representing a puzzle

2432: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 11,646
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,487
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 11,396
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,804
  5. Avatar for AlphaFold 15. AlphaFold 1 pt. 10,618
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,949
  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 23 pts. 11,935
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 21 pts. 11,894
  3. Avatar for Steven Pletsch 23. Steven Pletsch Lv 1 19 pts. 11,892
  4. Avatar for BarrySampson 24. BarrySampson Lv 1 17 pts. 11,885
  5. Avatar for guineapig 25. guineapig Lv 1 16 pts. 11,863
  6. Avatar for georg137 26. georg137 Lv 1 15 pts. 11,832
  7. Avatar for latin krepin 27. latin krepin Lv 1 13 pts. 11,830
  8. Avatar for alcor29 28. alcor29 Lv 1 12 pts. 11,819
  9. Avatar for orily1337 29. orily1337 Lv 1 11 pts. 11,761
  10. Avatar for silent gene 30. silent gene Lv 1 10 pts. 11,751

Comments