Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,530
  2. Avatar for Go Science 2. Go Science 68 pts. 11,324
  3. Avatar for Contenders 3. Contenders 44 pts. 11,101
  4. Avatar for Australia 4. Australia 27 pts. 11,100
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,008
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,925
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,923
  8. Avatar for VeFold 8. VeFold 3 pts. 10,733
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,611
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 10,559
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 25 pts. 10,925
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 23 pts. 10,923
  3. Avatar for latin krepin 23. latin krepin Lv 1 21 pts. 10,876
  4. Avatar for alcor29 24. alcor29 Lv 1 20 pts. 10,786
  5. Avatar for manu8170 25. manu8170 Lv 1 18 pts. 10,754
  6. Avatar for Hillbillie 26. Hillbillie Lv 1 17 pts. 10,733
  7. Avatar for silent gene 27. silent gene Lv 1 15 pts. 10,728
  8. Avatar for akaaka 28. akaaka Lv 1 14 pts. 10,703
  9. Avatar for heather-1 29. heather-1 Lv 1 13 pts. 10,688
  10. Avatar for Komeiji_Koishi 30. Komeiji_Koishi Lv 1 12 pts. 10,680

Comments