Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,530
  2. Avatar for Go Science 2. Go Science 68 pts. 11,324
  3. Avatar for Contenders 3. Contenders 44 pts. 11,101
  4. Avatar for Australia 4. Australia 27 pts. 11,100
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,008
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,925
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,923
  8. Avatar for VeFold 8. VeFold 3 pts. 10,733
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,611
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 10,559
  1. Avatar for rosie4loop 31. rosie4loop Lv 1 11 pts. 10,627
  2. Avatar for Joanna_H 32. Joanna_H Lv 1 10 pts. 10,611
  3. Avatar for maithra 33. maithra Lv 1 9 pts. 10,599
  4. Avatar for Steven Pletsch 34. Steven Pletsch Lv 1 8 pts. 10,577
  5. Avatar for Ikuso 35. Ikuso Lv 1 7 pts. 10,559
  6. Avatar for Larini 36. Larini Lv 1 7 pts. 10,550
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 6 pts. 10,539
  8. Avatar for roarshock 38. roarshock Lv 1 5 pts. 10,362
  9. Avatar for kitsoune 39. kitsoune Lv 1 5 pts. 10,317
  10. Avatar for ShadowTactics 40. ShadowTactics Lv 1 4 pts. 10,281

Comments