Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for WSU Bioc Spring 2016 11. WSU Bioc Spring 2016 1 pt. 10,222
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 10,079

  1. Avatar for Evelyn Bryan 81. Evelyn Bryan Lv 1 1 pt. 9,276
  2. Avatar for 22012491 82. 22012491 Lv 1 1 pt. 9,150
  3. Avatar for 0947664 83. 0947664 Lv 1 1 pt. 9,137
  4. Avatar for POLICARPIO 84. POLICARPIO Lv 1 1 pt. 9,086
  5. Avatar for rschen 85. rschen Lv 1 1 pt. 9,086
  6. Avatar for man_the_stan 86. man_the_stan Lv 1 1 pt. 9,086
  7. Avatar for Eldoblador 87. Eldoblador Lv 1 1 pt. 9,086
  8. Avatar for haleyg 88. haleyg Lv 1 1 pt. 9,086
  9. Avatar for DanielCentellas 89. DanielCentellas Lv 1 1 pt. 9,086
  10. Avatar for Dhanashree Bhate 90. Dhanashree Bhate Lv 1 1 pt. 9,086

Comments