Placeholder image of a protein
Icon representing a puzzle

2472: Electron Density Reconstruction 94

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 13, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 17,586
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 17,024
  3. Avatar for Firesign 13. Firesign 1 pt. 16,981
  4. Avatar for Window Group 14. Window Group 1 pt. 14,483

  1. Avatar for vs 31. vs Lv 1 3 pts. 17,532
  2. Avatar for zbp 32. zbp Lv 1 3 pts. 17,524
  3. Avatar for Trajan464 33. Trajan464 Lv 1 2 pts. 17,521
  4. Avatar for Larini 34. Larini Lv 1 2 pts. 17,508
  5. Avatar for hada 35. hada Lv 1 2 pts. 17,451
  6. Avatar for Dr.Sillem 36. Dr.Sillem Lv 1 1 pt. 17,449
  7. Avatar for Merf 37. Merf Lv 1 1 pt. 17,437
  8. Avatar for pfirth 38. pfirth Lv 1 1 pt. 17,434
  9. Avatar for spvincent 40. spvincent Lv 1 1 pt. 17,394

Comments