Placeholder image of a protein
Icon representing a puzzle

2472: Electron Density Reconstruction 94

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 13, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 17,586
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 17,024
  3. Avatar for Firesign 13. Firesign 1 pt. 16,981
  4. Avatar for Window Group 14. Window Group 1 pt. 14,483

  1. Avatar for lwelite 51. lwelite Lv 1 1 pt. 17,021
  2. Avatar for furi0us 52. furi0us Lv 1 1 pt. 17,020
  3. Avatar for Kimdonghyeon 53. Kimdonghyeon Lv 1 1 pt. 17,011
  4. Avatar for NickDanger 54. NickDanger Lv 1 1 pt. 16,981
  5. Avatar for mart0258 55. mart0258 Lv 1 1 pt. 16,960
  6. Avatar for osc 56. osc Lv 1 1 pt. 16,909
  7. Avatar for jungyao 57. jungyao Lv 1 1 pt. 16,691
  8. Avatar for jflat06 58. jflat06 Lv 1 1 pt. 14,483
  9. Avatar for mishaleclaire 59. mishaleclaire Lv 1 1 pt. 14,223

Comments