Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,498
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,862
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 4,514
  1. Avatar for maithra 31. maithra Lv 1 7 pts. 11,862
  2. Avatar for Th1sN@me!sN0tAPun 32. Th1sN@me!sN0tAPun Lv 1 6 pts. 11,846
  3. Avatar for AlphaFold2 33. AlphaFold2 Lv 1 5 pts. 11,756
  4. Avatar for nicobul 34. nicobul Lv 1 5 pts. 11,749
  5. Avatar for akaaka 35. akaaka Lv 1 4 pts. 11,703
  6. Avatar for BarrySampson 36. BarrySampson Lv 1 4 pts. 11,651
  7. Avatar for mengzach 37. mengzach Lv 1 3 pts. 11,607
  8. Avatar for vybi 38. vybi Lv 1 3 pts. 11,568
  9. Avatar for Trajan464 39. Trajan464 Lv 1 2 pts. 11,551
  10. Avatar for heather-1 40. heather-1 Lv 1 2 pts. 11,525

Comments