Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,498
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,862
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 4,514
  1. Avatar for messier81 41. messier81 Lv 1 2 pts. 11,506
  2. Avatar for ShadowTactics 42. ShadowTactics Lv 1 2 pts. 11,498
  3. Avatar for Dr.Sillem 43. Dr.Sillem Lv 1 2 pts. 11,490
  4. Avatar for Arne Heessels 44. Arne Heessels Lv 1 1 pt. 11,436
  5. Avatar for Alistair69 45. Alistair69 Lv 1 1 pt. 11,377
  6. Avatar for DScott 46. DScott Lv 1 1 pt. 11,354
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 11,322
  8. Avatar for haleyg 48. haleyg Lv 1 1 pt. 11,319
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 11,279
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 11,256

Comments