Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,872
  2. Avatar for Go Science 2. Go Science 65 pts. 12,741
  3. Avatar for Contenders 3. Contenders 41 pts. 12,679
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 12,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 12,495
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,176
  7. Avatar for Australia 7. Australia 4 pts. 12,148
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 12,058
  9. Avatar for VeFold 9. VeFold 1 pt. 11,756
  10. Avatar for Team China 10. Team China 1 pt. 11,506
  1. Avatar for g_b 11. g_b Lv 1 47 pts. 12,506
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 43 pts. 12,495
  3. Avatar for gmn 13. gmn Lv 1 40 pts. 12,346
  4. Avatar for Marvelz 14. Marvelz Lv 1 36 pts. 12,330
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 33 pts. 12,328
  6. Avatar for Galaxie 16. Galaxie Lv 1 30 pts. 12,248
  7. Avatar for gdnskye 17. gdnskye Lv 1 28 pts. 12,237
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 25 pts. 12,209
  9. Avatar for TheGUmmer 19. TheGUmmer Lv 1 23 pts. 12,176
  10. Avatar for fpc 20. fpc Lv 1 21 pts. 12,173

Comments