Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,872
  2. Avatar for Go Science 2. Go Science 65 pts. 12,741
  3. Avatar for Contenders 3. Contenders 41 pts. 12,679
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 12,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 12,495
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,176
  7. Avatar for Australia 7. Australia 4 pts. 12,148
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 12,058
  9. Avatar for VeFold 9. VeFold 1 pt. 11,756
  10. Avatar for Team China 10. Team China 1 pt. 11,506
  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 19 pts. 12,158
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 17 pts. 12,148
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 16 pts. 12,147
  4. Avatar for alcor29 24. alcor29 Lv 1 14 pts. 12,112
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 13 pts. 12,082
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 11 pts. 12,072
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 10 pts. 12,058
  8. Avatar for rosie4loop 28. rosie4loop Lv 1 9 pts. 12,008
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 8 pts. 11,983
  10. Avatar for Larini 30. Larini Lv 1 7 pts. 11,942

Comments