2475: Electron Density Reconstruction 95

Closed since over 1 year ago

Summary

• Created: June 21, 2024
• Expires: July 04, 2024 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

• Sequence: MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups

• 1. Anthropic Dreams 100 pts. 41,361
• 2. L'Alliance Francophone 70 pts. 41,255
• 3. Marvin's bunch 47 pts. 41,033
• 4. Go Science 30 pts. 41,021
• 5. Contenders 19 pts. 40,945
• 6. Australia 11 pts. 40,776
• 7. FamilyBarmettler 7 pts. 40,642
• 8. Void Crushers 4 pts. 40,578
• 9. Team China 2 pts. 40,287
• 10. VeFold 1 pt. 40,242

Top soloists

• 11. Galaxie 38 pts. 41,010
• 12. Sandrix72 34 pts. 40,989
• 13. Bletchley Park 30 pts. 40,945
• 14. akaaka 27 pts. 40,930
• 15. AlkiP0Ps 24 pts. 40,776
• 16. BootsMcGraw 22 pts. 40,740
• 17. drumpeter18yrs9yrs 19 pts. 40,728
• 18. NPrincipi 17 pts. 40,661
• 19. WBarme1234 15 pts. 40,642
• 20. orily1337 13 pts. 40,637