Placeholder image of a protein
Icon representing a puzzle

2475: Electron Density Reconstruction 95

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 21, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 41,361
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 70 pts. 41,255
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 41,033
  4. Avatar for Go Science 4. Go Science 30 pts. 41,021
  5. Avatar for Contenders 5. Contenders 19 pts. 40,945
  6. Avatar for Australia 6. Australia 11 pts. 40,776
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 40,642
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 40,578
  9. Avatar for Team China 9. Team China 2 pts. 40,287
  10. Avatar for VeFold 10. VeFold 1 pt. 40,242
  1. Avatar for alyssa_d_V2.0 51. alyssa_d_V2.0 Lv 1 1 pt. 37,833
  2. Avatar for AaronMcDonald 52. AaronMcDonald Lv 1 1 pt. 36,715
  3. Avatar for jflat06 53. jflat06 Lv 1 1 pt. 15,640
  4. Avatar for ingoneato 54. ingoneato Lv 1 1 pt. 15,160
  5. Avatar for AlphaFold2 55. AlphaFold2 Lv 1 1 pt. 15,160
  6. Avatar for Sciren 56. Sciren Lv 1 1 pt. 15,160
  7. Avatar for murasame 57. murasame Lv 1 1 pt. 15,160

Comments