Placeholder image of a protein
Icon representing a puzzle

2480: Electron Density Reconstruction 97

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
MHHHHHHMKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPG

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 12,719

  1. Avatar for Vinara 41. Vinara Lv 1 1 pt. 21,401
  2. Avatar for Arne Heessels 42. Arne Heessels Lv 1 1 pt. 21,368
  3. Avatar for osc 43. osc Lv 1 1 pt. 21,356
  4. Avatar for DScott 44. DScott Lv 1 1 pt. 21,332
  5. Avatar for juanda097 45. juanda097 Lv 1 1 pt. 21,260
  6. Avatar for rinze 46. rinze Lv 1 1 pt. 21,234
  7. Avatar for DrBabs 47. DrBabs Lv 1 1 pt. 21,121
  8. Avatar for furi0us 48. furi0us Lv 1 1 pt. 21,049
  9. Avatar for Swapper242 49. Swapper242 Lv 1 1 pt. 20,948
  10. Avatar for platinum9091 50. platinum9091 Lv 1 1 pt. 20,868

Comments