Icon representing a puzzle

2479: Revisiting Puzzle 63: Spinach Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
July 10, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 6,384

  1. Avatar for Gerom 41. Gerom Lv 1 1 pt. 10,178
  2. Avatar for Merf 42. Merf Lv 1 1 pt. 10,165
  3. Avatar for zbp 43. zbp Lv 1 1 pt. 10,033
  4. Avatar for carxo 44. carxo Lv 1 1 pt. 9,663
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 9,598
  6. Avatar for pfirth 46. pfirth Lv 1 1 pt. 9,588
  7. Avatar for rinze 47. rinze Lv 1 1 pt. 9,473
  8. Avatar for osc 48. osc Lv 1 1 pt. 9,151
  9. Avatar for platinum9091 49. platinum9091 Lv 1 1 pt. 8,474
  10. Avatar for mibrammall 50. mibrammall Lv 1 1 pt. 8,301

Comments