Icon representing a puzzle

2479: Revisiting Puzzle 63: Spinach Protein

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 10, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,356
  2. Avatar for Go Science 2. Go Science 60 pts. 11,355
  3. Avatar for Contenders 3. Contenders 33 pts. 11,261
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 11,149
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 11,095
  6. Avatar for Marvin's bunch 6. Marvin's bunch 4 pts. 11,064
  7. Avatar for VeFold 7. VeFold 2 pts. 11,043
  8. Avatar for Australia 8. Australia 1 pt. 10,940
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,907
  10. Avatar for Russian team 10. Russian team 1 pt. 10,178

  1. Avatar for Gerom 41. Gerom Lv 1 1 pt. 10,178
  2. Avatar for Merf 42. Merf Lv 1 1 pt. 10,165
  3. Avatar for zbp 43. zbp Lv 1 1 pt. 10,033
  4. Avatar for carxo 44. carxo Lv 1 1 pt. 9,663
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 9,598
  6. Avatar for pfirth 46. pfirth Lv 1 1 pt. 9,588
  7. Avatar for rinze 47. rinze Lv 1 1 pt. 9,473
  8. Avatar for osc 48. osc Lv 1 1 pt. 9,151
  9. Avatar for platinum9091 49. platinum9091 Lv 1 1 pt. 8,474
  10. Avatar for mibrammall 50. mibrammall Lv 1 1 pt. 8,301

Comments