Icon representing a puzzle

2479: Revisiting Puzzle 63: Spinach Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 10, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,356
  2. Avatar for Go Science 2. Go Science 60 pts. 11,355
  3. Avatar for Contenders 3. Contenders 33 pts. 11,261
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 11,149
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 11,095
  6. Avatar for Marvin's bunch 6. Marvin's bunch 4 pts. 11,064
  7. Avatar for VeFold 7. VeFold 2 pts. 11,043
  8. Avatar for Australia 8. Australia 1 pt. 10,940
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,907
  10. Avatar for Russian team 10. Russian team 1 pt. 10,178
  1. Avatar for TheGUmmer 21. TheGUmmer Lv 1 13 pts. 10,907
  2. Avatar for fpc 22. fpc Lv 1 12 pts. 10,906
  3. Avatar for SemperRabbit 23. SemperRabbit Lv 1 10 pts. 10,903
  4. Avatar for NPrincipi 24. NPrincipi Lv 1 9 pts. 10,881
  5. Avatar for BootsMcGraw 25. BootsMcGraw Lv 1 8 pts. 10,872
  6. Avatar for alcor29 26. alcor29 Lv 1 7 pts. 10,808
  7. Avatar for vs 27. vs Lv 1 6 pts. 10,791
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 5 pts. 10,764
  9. Avatar for g_b 29. g_b Lv 1 5 pts. 10,695
  10. Avatar for manu8170 30. manu8170 Lv 1 4 pts. 10,619

Comments