Icon representing a puzzle

2479: Revisiting Puzzle 63: Spinach Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 10, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,356
  2. Avatar for Go Science 2. Go Science 60 pts. 11,355
  3. Avatar for Contenders 3. Contenders 33 pts. 11,261
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 11,149
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 11,095
  6. Avatar for Marvin's bunch 6. Marvin's bunch 4 pts. 11,064
  7. Avatar for VeFold 7. VeFold 2 pts. 11,043
  8. Avatar for Australia 8. Australia 1 pt. 10,940
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,907
  10. Avatar for Russian team 10. Russian team 1 pt. 10,178
  1. Avatar for nicobul 51. nicobul Lv 1 1 pt. 7,831
  2. Avatar for heather-1 52. heather-1 Lv 1 1 pt. 7,640
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 7,453
  4. Avatar for Vojtenzi CZE 54. Vojtenzi CZE Lv 1 1 pt. 6,752
  5. Avatar for TgamesPi 55. TgamesPi Lv 1 1 pt. 6,509
  6. Avatar for Sammy3c2b1a0 56. Sammy3c2b1a0 Lv 1 1 pt. 6,384
  7. Avatar for juanda097 57. juanda097 Lv 1 1 pt. 6,381
  8. Avatar for furi0us 58. furi0us Lv 1 1 pt. 6,156
  9. Avatar for reoode 59. reoode Lv 1 1 pt. 4,941
  10. Avatar for erbol 60. erbol Lv 1 1 pt. 0

Comments