Icon representing a puzzle

2486: Revisiting Puzzle 66: Cytochrome

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,886
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,776
  3. Avatar for Team China 13. Team China 1 pt. 9,607
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 9,427
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,426
  6. Avatar for Window Group 16. Window Group 1 pt. 8,206
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,737
  1. Avatar for ucad 41. ucad Lv 1 3 pts. 10,002
  2. Avatar for rosie4loop 42. rosie4loop Lv 1 2 pts. 9,989
  3. Avatar for heather-1 43. heather-1 Lv 1 2 pts. 9,932
  4. Avatar for nicobul 44. nicobul Lv 1 2 pts. 9,921
  5. Avatar for Larini 45. Larini Lv 1 2 pts. 9,889
  6. Avatar for pfirth 46. pfirth Lv 1 2 pts. 9,888
  7. Avatar for ShadowTactics 47. ShadowTactics Lv 1 1 pt. 9,886
  8. Avatar for Tian00 48. Tian00 Lv 1 1 pt. 9,874
  9. Avatar for nancy_annys 49. nancy_annys Lv 1 1 pt. 9,817
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 9,805

Comments