Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 10,189
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,653
  3. Avatar for Androids 13. Androids 1 pt. 9,481
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,354
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,272
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,038
  1. Avatar for polymerase 61. polymerase Lv 1 1 pt. 9,384
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 9,357
  3. Avatar for Tlaloc 63. Tlaloc Lv 1 1 pt. 9,354
  4. Avatar for Kimdonghyeon 64. Kimdonghyeon Lv 1 1 pt. 9,301
  5. Avatar for JOE.CADILLAC555 65. JOE.CADILLAC555 Lv 1 1 pt. 9,299
  6. Avatar for furi0us 66. furi0us Lv 1 1 pt. 9,290
  7. Avatar for osc 67. osc Lv 1 1 pt. 9,277
  8. Avatar for Sammy3c2b1a0 68. Sammy3c2b1a0 Lv 1 1 pt. 9,272
  9. Avatar for alrianne 69. alrianne Lv 1 1 pt. 9,252
  10. Avatar for Giantbluefish 70. Giantbluefish Lv 1 1 pt. 9,122

Comments