Placeholder image of a protein
Icon representing a puzzle

2484: Electron Density Reconstruction 98

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 17, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
GPMPGKKFVARVEEILHDPGRTAPVARVKFEDGTKRVVIIPKGIKVGDVVEVKKV

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 13,003
  2. Avatar for Team China 12. Team China 1 pt. 12,827
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 12,645
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 9,839
  1. Avatar for fpc 11. fpc Lv 1 46 pts. 13,184
  2. Avatar for blazegeek 12. blazegeek Lv 1 42 pts. 13,182
  3. Avatar for AlkiP0Ps 13. AlkiP0Ps Lv 1 38 pts. 13,181
  4. Avatar for drumpeter18yrs9yrs 14. drumpeter18yrs9yrs Lv 1 35 pts. 13,173
  5. Avatar for BarrySampson 15. BarrySampson Lv 1 32 pts. 13,165
  6. Avatar for alcor29 16. alcor29 Lv 1 29 pts. 13,165
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 27 pts. 13,156
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 24 pts. 13,149
  9. Avatar for akaaka 19. akaaka Lv 1 22 pts. 13,145
  10. Avatar for ichwilldiesennamen 20. ichwilldiesennamen Lv 1 20 pts. 13,144

Comments