Placeholder image of a protein
Icon representing a puzzle

2484: Electron Density Reconstruction 98

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 17, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
GPMPGKKFVARVEEILHDPGRTAPVARVKFEDGTKRVVIIPKGIKVGDVVEVKKV

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 13,003
  2. Avatar for Team China 12. Team China 1 pt. 12,827
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 12,645
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 9,839
  1. Avatar for artsyambie6 61. artsyambie6 Lv 1 1 pt. 12,557
  2. Avatar for le malouin 62. le malouin Lv 1 1 pt. 12,349
  3. Avatar for Le_Lorrain 63. Le_Lorrain Lv 1 1 pt. 12,228
  4. Avatar for raspberryenthusiast 64. raspberryenthusiast Lv 1 1 pt. 12,201
  5. Avatar for Eclegv 65. Eclegv Lv 1 1 pt. 10,432
  6. Avatar for Weyzox 66. Weyzox Lv 1 1 pt. 9,839
  7. Avatar for juleni 67. juleni Lv 1 1 pt. 9,698
  8. Avatar for Bletchley Park 68. Bletchley Park Lv 1 1 pt. 9,412
  9. Avatar for yetally3 69. yetally3 Lv 1 1 pt. 9,412

Comments