Placeholder image of a protein
Icon representing a puzzle

2501: Refine Density Reconstruction 4

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 28, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2137, which was Reconstruction Puzzle 7, but now we have the Refine Density tool available to make folds even better! Learn about the new tool here: https://fold.it/forum/blog/new-tool-refine-density. This one won't allow loading solutions from that puzzle.

Sequence
TAAAKFERQHMDSPDLGTDDDDKAMADIGSDFMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,171
  2. Avatar for Go Science 2. Go Science 65 pts. 19,948
  3. Avatar for Contenders 3. Contenders 41 pts. 19,761
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 19,592
  5. Avatar for Team China 5. Team China 14 pts. 19,416
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,371
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 19,340
  8. Avatar for Australia 8. Australia 2 pts. 19,084
  9. Avatar for VeFold 9. VeFold 1 pt. 18,864
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,370

  1. Avatar for Mohoernchen 41. Mohoernchen Lv 1 3 pts. 17,002
  2. Avatar for Dr.Sillem 42. Dr.Sillem Lv 1 2 pts. 16,965
  3. Avatar for Idiotboy 43. Idiotboy Lv 1 2 pts. 16,921
  4. Avatar for carsonfb 44. carsonfb Lv 1 2 pts. 16,898
  5. Avatar for carxo 45. carxo Lv 1 2 pts. 16,714
  6. Avatar for SemperRabbit 46. SemperRabbit Lv 1 1 pt. 16,665
  7. Avatar for Larini 47. Larini Lv 1 1 pt. 16,585
  8. Avatar for rinze 48. rinze Lv 1 1 pt. 16,268
  9. Avatar for AlphaFold2 49. AlphaFold2 Lv 1 1 pt. 15,770
  10. Avatar for Yayanglo 50. Yayanglo Lv 1 1 pt. 15,748

Comments