Placeholder image of a protein
Icon representing a puzzle

2501: Refine Density Reconstruction 4

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
August 28, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2137, which was Reconstruction Puzzle 7, but now we have the Refine Density tool available to make folds even better! Learn about the new tool here: https://fold.it/forum/blog/new-tool-refine-density. This one won't allow loading solutions from that puzzle.

Sequence
TAAAKFERQHMDSPDLGTDDDDKAMADIGSDFMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 20,171
  2. Avatar for Go Science 2. Go Science 65 pts. 19,948
  3. Avatar for Contenders 3. Contenders 41 pts. 19,761
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 19,592
  5. Avatar for Team China 5. Team China 14 pts. 19,416
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,371
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 19,340
  8. Avatar for Australia 8. Australia 2 pts. 19,084
  9. Avatar for VeFold 9. VeFold 1 pt. 18,864
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,370
  1. Avatar for frostschutz 61. frostschutz Lv 1 1 pt. 14,133
  2. Avatar for Hexafluorouranate 62. Hexafluorouranate Lv 1 1 pt. 14,109
  3. Avatar for deathbat_87 63. deathbat_87 Lv 1 1 pt. 13,782
  4. Avatar for Sammy3c2b1a0 64. Sammy3c2b1a0 Lv 1 1 pt. 13,681
  5. Avatar for Kimdonghyeon 65. Kimdonghyeon Lv 1 1 pt. 11,965
  6. Avatar for NameGoes 66. NameGoes Lv 1 1 pt. 11,890
  7. Avatar for DodoBird 67. DodoBird Lv 1 1 pt. 9,812
  8. Avatar for apetrides 68. apetrides Lv 1 1 pt. 7,950
  9. Avatar for jadephoenix 69. jadephoenix Lv 1 1 pt. 5,658
  10. Avatar for horowsah 70. horowsah Lv 1 1 pt. 3,353

Comments